GNA15 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: GNA15 belongs to the G-alpha family. Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GNA15

Key Reference: Johansson,B.B., (2005) FEBS J. 272 (20), 5365-5377

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: ARSLTWRCCPWCLTEDEKAAARVDQEINRILLEQKKQDRGELKLLLLGPG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Guanine nucleotide-binding protein subunit alpha-15

Protein Size: 374

Purification: Affinity Purified

Subunit: alpha-15

• Artikelnummer: AVIARP58472_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58472_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Guinea Pig, Cow (Bovine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 2769
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin