GNAI2 Antibody - C-terminal region : FITC

GNAI2 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP54632_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. The G(i) proteins are involved in hormonal regulation of adenylate cyclase: they inhibit the cyclase in response to beta-adrenergic stimuli.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GNAI2

Key Reference: Bushfield,M., J. Cell. Sci. 120 (PT 13), 2171-2178 (2007)

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: EYTGANKYDEAASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Guanine nucleotide-binding protein G(i) subunit alpha-2

Protein Size: 355

Purification: Affinity Purified

Subunit: alpha-2
Mehr Informationen
Artikelnummer AVIARP54632_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54632_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 2771
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×