GNAI3 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: GNAI3 is a guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. G(k) is the stimulatory G protein of receptor-regulated K+ channels.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GNAI3

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: TTGIVETHFTFKDLYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Guanine nucleotide-binding protein G(k) subunit alpha

Protein Size: 354

Purification: Affinity Purified

Subunit: alpha

• Artikelnummer: AVIARP58906_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58906_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 2773
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin