GNAO1 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: Activated Goalpha interacted directly with PLZF, and enhanced its function as a transcriptional and cell growth suppressor. Goalpha might play a role in mediating extracellular signal-regulated kinase activation by G protein-coupled receptors in the brain

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GNAO1

Key Reference: Won,J.H., (2008) Cell. Signal. 20 (5), 884-891

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: PVVYSNTIQSLAAIVRAMDTLGIEYGDKERKADAKMVCDVVSRMEDTEPF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Guanine nucleotide-binding protein G(o) subunit alpha

Protein Size: 354

Purification: Affinity Purified

Subunit: alpha

• Artikelnummer: AVIARP55424_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55424_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 2775
• Wirt: Rabbit