GNAO1 Antibody - N-terminal region : FITC

GNAO1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55424_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Activated Goalpha interacted directly with PLZF, and enhanced its function as a transcriptional and cell growth suppressor. Goalpha might play a role in mediating extracellular signal-regulated kinase activation by G protein-coupled receptors in the brain

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GNAO1

Key Reference: Won,J.H., (2008) Cell. Signal. 20 (5), 884-891

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: PVVYSNTIQSLAAIVRAMDTLGIEYGDKERKADAKMVCDVVSRMEDTEPF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Guanine nucleotide-binding protein G(o) subunit alpha

Protein Size: 354

Purification: Affinity Purified

Subunit: alpha
Mehr Informationen
Artikelnummer AVIARP55424_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55424_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 2775
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×