Gnaq Antibody - middle region : Biotin

Gnaq Antibody - middle region : Biotin
Artikelnummer
AVIARP54636_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Gnaq may mediate cardiomyocyte growth and hypertrophy; overexpression may facilitate apoptosis by inhibiting the PI3K/phosphoinositide-dependent kinase-1/Akt cell survival signaling pathway.

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: RRREYQLSDSTKYYLNDLDRVADPSYLPTQQDVLRVRVPTTGIIEYPFDL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Guanine nucleotide-binding protein G(q) subunit alpha

Protein Size: 359

Purification: Affinity Purified

Subunit: alpha
Mehr Informationen
Artikelnummer AVIARP54636_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54636_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 81666
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×