Gnaq Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Gnaq may mediate cardiomyocyte growth and hypertrophy; overexpression may facilitate apoptosis by inhibiting the PI3K/phosphoinositide-dependent kinase-1/Akt cell survival signaling pathway.

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: RRREYQLSDSTKYYLNDLDRVADPSYLPTQQDVLRVRVPTTGIIEYPFDL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Guanine nucleotide-binding protein G(q) subunit alpha

Protein Size: 359

Purification: Affinity Purified

Subunit: alpha

• Artikelnummer: AVIARP54636_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54636_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 81666
• Wirt: Rabbit