GNB1 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit. These subunits are encoded by families of related genes. GNB1 is a bet

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GNB1

Key Reference: Ueda,H., (2008) J. Biol. Chem. 283 (4), 1946-1953

Molecular Weight: 37kDa

Peptide Sequence: Synthetic peptide located within the following region: MSELDQLRQEAEQLKNQIRDARKACADATLSQITNNIDPVGRIQMRTRRT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1

Protein Size: 340

Purification: Affinity Purified

Subunit: beta-1

• Artikelnummer: AVIARP54637_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54637_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 2782
• Wirt: Rabbit