GNB4 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit. These subunits are encoded by families of related genes. This gene encodes a beta subunit. Beta subunits are important regulators of alpha subunits, as well as of certain signal transduction receptors and effectors.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GNB4

Molecular Weight: 37kDa

Peptide Sequence: Synthetic peptide located within the following region: DGMCRQSFTGHVSDINAVSFFPNGYAFATGSDDATCRLFDLRADQELLLY

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Guanine nucleotide-binding protein subunit beta-4

Protein Size: 340

Purification: Affinity Purified

Specificity#: Gene Symbol:GNB1,GNB2,GNB3
Protein Accession#:NP_002065,NP_005264,NP_002066
Nucleotide Accession#:NM_002074,NM_005273,NM_002075
Swissprot ID:P62873,P62879,P16520


Subunit: beta1-4

• Artikelnummer: AVIARP57549_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57549_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 59345
• Wirt: Rabbit