GNL3 Antibody - N-terminal region : Biotin

GNL3 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP58826_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: GNL3 may be required to maintain the proliferative capacity of stem cells and may play an important role in tumorigenesis.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GNL3

Key Reference: Ma,H. (2007) Mol. Biol. Cell 18 (7), 2630-2635

Molecular Weight: 60kDa

Peptide Sequence: Synthetic peptide located within the following region: MTCHKRYKIQKKVREHHRKLRKEAKKRGHKKPRKDPGVPNSAPFKEALLR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Guanine nucleotide-binding protein-like 3

Protein Size: 537

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58826_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58826_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 26354
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×