GNL3 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: GNL3 may be required to maintain the proliferative capacity of stem cells and may play an important role in tumorigenesis.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GNL3

Key Reference: Ma,H. (2007) Mol. Biol. Cell 18 (7), 2630-2635

Molecular Weight: 60kDa

Peptide Sequence: Synthetic peptide located within the following region: MTCHKRYKIQKKVREHHRKLRKEAKKRGHKKPRKDPGVPNSAPFKEALLR

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Guanine nucleotide-binding protein-like 3

Protein Size: 537

Purification: Affinity Purified

• Artikelnummer: AVIARP58826_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58826_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 26354
• Wirt: Rabbit
• Konjugat: Conjugated, HRP