GNL3L Antibody - N-terminal region : Biotin

GNL3L Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP58798_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: GNL3L is required for normal processing of ribosomal pre-rRNA and cell proliferation.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GNL3L

Key Reference: Rao,M.R., (2006) J. Mol. Biol. 364 (4), 637-654

Molecular Weight: 65kDa

Peptide Sequence: Synthetic peptide located within the following region: MMKLRHKNKKPGEGSKGHKKISWPYPQPAKQNGKKATSKVPSAPHFVHPN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Guanine nucleotide-binding protein-like 3-like protein

Protein Size: 582

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58798_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58798_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 54552
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×