GOLGA1 Antibody - N-terminal region : HRP

GOLGA1 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP54639_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The Golgi apparatus, which participates in glycosylation and transport of proteins and lipids in the secretory pathway, consists of a series of stacked cisternae (flattened membrane sacs). Interactions between the Golgi and microtubules are thought to be important for the reorganization of the Golgi after it fragments during mitosis. This gene encodes one of the golgins, a family of proteins localized to the Golgi. This encoded protein is associated with Sjogren's syndrome.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GOLGA1

Molecular Weight: 88kDa

Peptide Sequence: Synthetic peptide located within the following region: RPGGATRIPRSVSKESVASMGADSGDDFASDGSSSREDLSSQLLRRNEQI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Golgin subfamily A member 1

Protein Size: 767

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54639_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54639_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 2800
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×