GOPC Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a Golgi protein with a PDZ domain. The PDZ domain is globular and proteins which contain them bind other proteins through short motifs near the C-termini. Mice which are deficient in the orthologous protein have globozoospermia and are infertile. Multiple transcript variants encoding different isoforms have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human GOPC

Key Reference: N/A

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: QLEAEIHLHRHKTVIRACRGRNDLKRPMQAPPGHDQDSLKKSQGVGPIRK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Golgi-associated PDZ and coiled-coil motif-containing protein

Protein Size: 462

Purification: Affinity purified

• Artikelnummer: AVIARP58936_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58936_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 57120
• Wirt: Rabbit
• Konjugat: Conjugated, FITC