GPX4 Antibody - middle region : HRP

GPX4 Antibody - middle region : HRP
Artikelnummer
AVIARP58473_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Glutathione peroxidase catalyzes the reduction of hydrogen peroxide, organic hydroperoxide, and lipid peroxides by reduced glutathione and functions in the protection of cells against oxidative damage. Human plasma glutathione peroxidase has been shown to be a selenium-containing enzyme and the UGA codon is translated into a selenocysteine. Through alternative splicing and transcription initiation, rat produces proteins that localize to the nucleus, mitochondrion, and cytoplasm. In humans, experimental evidence for alternative splicing exists; alternative transcription initiation and the cleavage sites of the mitochondrial and nuclear transit peptides need to be experimentally verified.Glutathione peroxidase catalyzes the reduction of hydrogen peroxide, organic hydroperoxide, and lipid peroxides by reduced glutathione and functions in the protection of cells against oxidative damage. Human plasma glutathione peroxidase has been shown to be a selenium-containing enzyme and the UGA codon is translated into a selenocysteine. Through alternative splicing and transcription initiation, rat produces proteins that localize to the nucleus, mitochondrion, and cytoplasm. In humans, experimental evidence for alternative splicing exists; alternative transcription initiation and the cleavage sites of the mitochondrial and nuclear transit peptides need to be experimentally verified.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GPX4

Key Reference: Peters,U., (2008) Cancer Epidemiol. Biomarkers Prev. 17 (5), 1144-1154

Molecular Weight: 22kDa

Peptide Sequence: Synthetic peptide located within the following region: QUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Phospholipid hydroperoxide glutathione peroxidase, mitochondrial

Protein Size: 197

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58473_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58473_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Goat (Caprine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 2879
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×