GRN Antibody - middle region : HRP

GRN Antibody - middle region : HRP
Artikelnummer
AVIARP54642_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Granulins are a family of secreted, glycosylated peptides that are cleaved from a single precursor protein with 7.5 repeats of a highly conserved 12-cysteine granulin/epithelin motif. The 88 kDa precursor protein, progranulin, is also called proepithelin and PC cell-derived growth factor. Cleavage of the signal peptide produces mature granulin which can be further cleaved into a variety of active, 6 kDa peptides. These smaller cleavage products are named granulin A, granulin B, granulin C, etc. Epithelins 1 and 2 are synonymous with granulins A and B, respectively. Both the peptides and intact granulin protein regulate cell growth. However, different members of the granulin protein family may act as inhibitors, stimulators, or have dual actions on cell growth. Granulin family members are important in normal development, wound healing, and tumorigenesis.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human GRN

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: QAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSLPDPQAL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Granulins

Protein Size: 438

Purification: Affinity purified
Mehr Informationen
Artikelnummer AVIARP54642_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54642_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 2896
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×