GSPT2 Antibody - middle region : HRP

GSPT2 Antibody - middle region : HRP
Artikelnummer
AVIARP55357_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: GSPT2 is closely related to GSPT1, a GTP-binding protein that plays an essential role at the G1- to S-phase transition of the cell cycle in yeast and human cells. GSPT1 is a positive regulator of translational accuracy and, in a binary complex with eRF1, functions as a polypeptide chain release factor.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GSPT2

Molecular Weight: 69kDa

Peptide Sequence: Synthetic peptide located within the following region: GANIKEQSDFCPWYTGLPFIPYLDNLPNFNRSIDGPIRLPIVDKYKDMGT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Eukaryotic peptide chain release factor GTP-binding subunit ERF3B

Protein Size: 628

Purification: Affinity Purified

Subunit: ERF3B
Mehr Informationen
Artikelnummer AVIARP55357_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55357_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23708
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×