Guf1 Antibody - C-terminal region : HRP

Guf1 Antibody - C-terminal region : HRP
Artikelnummer
AVIARP57564_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Guf1 promotes mitochondrial protein synthesis. It may act as a fidelity factor of the translation reaction, by catalyzing a one-codon backward translocation of tRNAs on improperly translocated ribosomes. It binds to mitochondrial ribosomes in a GTP-dependent manner.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 72kDa

Peptide Sequence: Synthetic peptide located within the following region: YLFPLNEIVVDFYDSLKSLSSGYASFDYEDAGYQTAELVKMDILLNGNMV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Translation factor Guf1, mitochondrial

Protein Size: 651

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57564_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57564_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 231279
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×