HAPLN2 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: HAPLN2 mediates a firm binding of versican V2 to hyaluronic acid.HAPLN2 may play a pivotal role in the formation of the hyaluronan-associated matrix in the central nervous system (CNS) which facilitates neuronal conduction and general structural stabilization. HAPLN2 binds to hyaluronic acid.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HAPLN2

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: LDQCDGGWLADGSVRFPITTPRPRCGGLPDPGVRSFGFPRPQQAAYGTYC

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Hyaluronan and proteoglycan link protein 2

Protein Size: 340

Purification: Affinity Purified

• Artikelnummer: AVIARP57560_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57560_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 60484
• Wirt: Rabbit