HAUS7 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a subunit of the augmin complex, which regulates centrosome and mitotic spindle integrity, and is necessary for the completion of cytokinesis. The encoded protein was identified by interaction with ubiquitin C-terminal hydrolase 37. Alternative splicing results in multiple transcript variants.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human HAUS7

Molecular Weight: 37kDa

Peptide Sequence: Synthetic peptide located within the following region: DLNCPFLEGLYITEPKTIQELLCSPSEYRLEILEWMCTRVWPSLQDRFSS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: HAUS augmin-like complex subunit 7

Protein Size: 338

Purification: Affinity Purified

• Artikelnummer: AVIARP56967_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56967_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 55559
• Wirt: Rabbit