HAVCR2 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: HAVCR2 regulates macrophage activation. HAVCR2 inhibits T-helper type 1 lymphocyte (Th1)-mediated auto- and alloimmune responses and promotes immunological tolerance. HAVCR2 may be also involved in T-cell homing. HAVCR2 is the receptor for LGALS9.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human HAVCR2

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: IGIYIGAGICAGLALALIFGALIFKWYSHSKEKIQNLSLISLANLPPSGL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Hepatitis A virus cellular receptor 2

Protein Size: 301

Purification: Affinity Purified

• Artikelnummer: AVIARP59159_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP59159_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Dog (Canine), Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 84868
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin