hCG_1745121 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: The specific function of hCG_1745121 is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human hCG_1745121

Key Reference: Venter,J.C., (2001) Science 291 (5507), 1304-1351

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: MTPQSLLQTTLFLLSLLFLVQGAHGRGHREDFRFCSQRNQTHRSSLHYKP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Isoprenoid synthase domain-containing protein

Protein Size: 401

Purification: Affinity Purified

• Artikelnummer: AVIARP58634_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58634_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 729920
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin