Products from BPS Bioscience require a minimum order value above 400€
Encompassing Amino Acids: 21-32 of NS4A, linker (4 a.a.) and a.a. 3-181 of NS3
Amino Acid Sequence: MDYKDDDDKHHHHHHGCVVIVGRIVLSGSGSITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGLFRAAVCTRGVAKAVDFIPVENLETTMRS
Applications: Useful for the study of enzyme kinetics, screening inhibitors, and selectivity profiling.
Description: Fusion protein corresponding to theserine protease NS3 (a.a. 3-181) andcofactor NS4A (a.a. 21-32) from HepatitisC virus genotype 1a (HCV1a), GenBankAccession No. NC_004102, with Asp-to-Glu mutation on a.a. 168, and N-terminalFLAG-His tag, MW = 22.4 kDa,expressed in an E. coli expressionsystem.
Format: Aqueous buffer solution
Formulation: 40 mM Tris-HCl, pH 8.0, 110mM NaCl, 2.2 mM KCl, 0.04% Tween-20,20% glycerol, and 250 mM imidazole
Genbank: NC_004102
Storage Stability: At least 6 months at -80°C.
Tags: N-terminal FLAG-His-tags
Uniprot: P27958
Warnings: Avoid freeze/thaw cycles.
Biosafety Level: Not applicable (BSL-1)
References: 1. Lin, C., et al., Hepatitis C Virus. Norfolk (UK): Horizon Bioscience; 2006. Chapter 6.
2. Prabhu, R., et al., Exp Mol Pathol. 2004 Jun;76(3):242-52.