HEPACAM Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: HEPACAM is involved in regulating cell motility and cell-matrix interactions. HEPACAM may inhibit cell growth through suppression of cell proliferation.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HEPACAM

Molecular Weight: 46kDa

Peptide Sequence: Synthetic peptide located within the following region: LLLSDLQLADEGTYEVEISITDDTFTGEKTINLTVDVPISRPQVLVASTT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Hepatocyte cell adhesion molecule

Protein Size: 416

Purification: Affinity Purified

• Artikelnummer: AVIARP55504_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55504_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 220296
• Wirt: Rabbit