HIPK1 Antibody - middle region : Biotin

HIPK1 Antibody - middle region : Biotin
Artikelnummer
AVIARP55866_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: HIPK1 may play a role as a corepressor for homeodomain transcription factors. HIPK1 phosphorylates DAXX in response to stress, and mediates its translocation from the nucleus to the cytoplasm. HIPK1 may be involved in malignant squamous cell tumor formation.The protein encoded by this gene belongs to the Ser/Thr family of protein kinases and HIPK subfamily. It phosphorylates homeodomain transcription factors and may also function as a co-repressor for homeodomain transcription factors. Alternative splicing results in four transcript variants encoding four distinct isoforms.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HIPK1

Key Reference: Li,X., (2005) J. Biol. Chem. 280 (15), 15061-15070

Molecular Weight: 131kDa

Peptide Sequence: Synthetic peptide located within the following region: PLNLSQNQQSSAAPTSQERSSNPAPRRQQAFVAPLSQAPYTFQHGSPLHS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Homeodomain-interacting protein kinase 1

Protein Size: 1210

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55866_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55866_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 204851
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×