HISPPD1 Antibody - middle region : Biotin

HISPPD1 Antibody - middle region : Biotin
Artikelnummer
AVIARP55203_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Inositol phosphates (IPs) and diphosphoinositol phosphates (PP-IPs), also known as inositol pyrophosphates, act as cell signaling molecules. HISPPD1 has both IP6 kinase (EC 2.7.4.21) and PP-IP5 (also called IP7) kinase (EC 2.7.4.24) activities that produce the high-energy pyrophosphates PP-IP5 and PP2-IP4 (also called IP8), respectively.Inositol phosphates (IPs) and diphosphoinositol phosphates (PP-IPs), also known as inositol pyrophosphates, act as cell signaling molecules. HISPPD1 has both IP6 kinase (EC 2.7.4.21) and PP-IP5 (also called IP7) kinase (EC 2.7.4.24) activities that produce the high-energy pyrophosphates PP-IP5 and PP2-IP4 (also called IP8), respectively (Fridy et al., 2007 [PubMed 17690096]).[supplied by OMIM].

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HISPPD1

Key Reference: Choi,J.H., (2007) J. Biol. Chem. 282 (42), 30763-30775

Molecular Weight: 138kDa

Peptide Sequence: Synthetic peptide located within the following region: SLSSCQQRVKARLHEILQKDRDFTAEDYEKLTPSGSISLIKSMHLIKNPV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2

Protein Size: 1222

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55203_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55203_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23262
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×