HISPPD1 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Inositol phosphates (IPs) and diphosphoinositol phosphates (PP-IPs), also known as inositol pyrophosphates, act as cell signaling molecules. HISPPD1 has both IP6 kinase (EC 2.7.4.21) and PP-IP5 (also called IP7) kinase (EC 2.7.4.24) activities that produce the high-energy pyrophosphates PP-IP5 and PP2-IP4 (also called IP8), respectively.Inositol phosphates (IPs) and diphosphoinositol phosphates (PP-IPs), also known as inositol pyrophosphates, act as cell signaling molecules. HISPPD1 has both IP6 kinase (EC 2.7.4.21) and PP-IP5 (also called IP7) kinase (EC 2.7.4.24) activities that produce the high-energy pyrophosphates PP-IP5 and PP2-IP4 (also called IP8), respectively (Fridy et al., 2007 [PubMed 17690096]).[supplied by OMIM].

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HISPPD1

Key Reference: Choi,J.H., (2007) J. Biol. Chem. 282 (42), 30763-30775

Molecular Weight: 138kDa

Peptide Sequence: Synthetic peptide located within the following region: SLSSCQQRVKARLHEILQKDRDFTAEDYEKLTPSGSISLIKSMHLIKNPV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2

Protein Size: 1222

Purification: Affinity Purified

• Artikelnummer: AVIARP55203_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55203_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 23262
• Wirt: Rabbit