HIST2H2BF Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: HIST2H2BF is the core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HIST2H2BF

Key Reference: Kim,S.C., (2006) Mol. Cell 23 (4), 607-618

Molecular Weight: 14kDa

Peptide Sequence: Synthetic peptide located within the following region: MPDPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSVYVYKVLKQVH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Histone H2B type 2-F

Protein Size: 126

Purification: Affinity Purified

• Artikelnummer: AVIARP56220_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56220_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting, Chromatin Immunoprecipitation (ChIP)
• Human Gene ID: 440689
• Wirt: Rabbit