Histone H2a, Full Length, Biotin-labeled, His-tag Recombinant

Histone H2a, Full Length, Biotin-labeled, His-tag Recombinant
Artikelnummer
BPS52049
Verpackungseinheit
50 µg
Hersteller
BPS Bioscience

Verfügbarkeit: wird geladen...
Preis wird geladen...
Products from BPS Bioscience require a minimum order value above 400€

Encompassing Amino Acids: 2-130(end)

Amino Acid Sequence: MHHHHHHSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGKC

Applications: Useful as a substrate for histone methyltransferase and acetyltransferase assays. Ideal for screening small molecular inhibitors of histone modifying enzymes for drug discovery and HTS applications.

Description: Biotinylated Human Histone 2A, GenBank Accession No. NM_033445, a.a. 2-130(end) with N-terminal His-tag and C-terminal Cys. MW = 15 kDa, expressed in an E. coli expression system.

Format: Aqueous buffer solution

Formulation: 8 mM PBS pH 7.4, 110 mM NaCl, 2.2 mM KCl, 3 mM DTT, and 20% glycerol

Genbank: NM_033445

Host Cell Line: E. coli

Storage Stability: At least 6 months at -80°C.

Tags: N-terminal His-tag, Biotin

Uniprot: Q7L7L0

Warnings: Avoid freeze/thaw cycles.

Biosafety Level: Not applicable (BSL-1)

References: 1. Osley, M.A. Brief Funct. Genomic
Proteomic 5(3):179-89 (2006).
2. Wyrick, J.J. and Parra, M.A. Biochim
Biophys Acta. 1789(1):37-44 (2009).
3. Zhou, W., et al. Int J Biochem Cell Biol.
41(1):12-5 (2009).
Mehr Informationen
Artikelnummer BPS52049
Hersteller BPS Bioscience
Hersteller Artikelnummer 52049
Green Labware Nein
Verpackungseinheit 50 µg
Mengeneinheit STK
Produktinformation (PDF) Download
MSDS (PDF)
×