Histone H3, Full Length, Biotin-labeled, His-tag

Histone H3, Full Length, Biotin-labeled, His-tag
Artikelnummer
BPS52053
Verpackungseinheit
50 µg
Hersteller
BPS Bioscience

Verfügbarkeit: wird geladen...
Preis wird geladen...
Products from BPS Bioscience require a minimum order value above 400€

Encompassing Amino Acids: 2-136(end)

Amino Acid Sequence: MACHHHHHHARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEAAEAYLVGLFEDTNLAAIHAKRVTIMPKDIQLARRIRGERA

Applications: Useful as a substrate for histone methyltransferase and acetyltransferase assays. Ideal for screening small molecular inhibitors of histone modifying enzymes for drug discovery and HTS applications.

Description: Biotinylated Human Histone 3, GenBank Accession No. NM_003532, a.a. 2-136(end) with N-terminal Met-Ala-Cys-6xHis-tag (C97A,C111A). MW = 16.3 kDa, expressed in an E. coli expression system.

Format: Aqueous buffer solution

Formulation: 8 mM PBS pH 7.4, 110 mM NaCl, 2.2 mM KCl, 3 mM DTT, and 20% glycerol

Genbank: NM_003532

Host Cell Line: E. coli

Storage Stability: At least 6 months at -80°C.

Tags: N-terminal His-tag, Biotin

Uniprot: P68431

Warnings: Avoid freeze/thaw cycles.

Biosafety Level: Not applicable (BSL-1)

References: 1. Loyola, A. et al., Mol. Cell 24 (2), 309-
316 (2006).
2. Hans, F. and Dimitrov, S. Oncogene
20(24), 3021-3027 (2001).
Mehr Informationen
Artikelnummer BPS52053
Hersteller BPS Bioscience
Hersteller Artikelnummer 52053
Green Labware Nein
Verpackungseinheit 50 µg
Mengeneinheit STK
Produktinformation (PDF) Download
MSDS (PDF)
×