HMCES Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: HMCES specifically binds 5-hydroxymethylcytosine (5hmC)- containing DNA in stem cells, suggesting that it acts as a specific reader of 5hmC in stem cells (By similarity). IT may act as a peptidase; experimental evidences are however required to confirm this prediction.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human HMCES

Key Reference: N/A

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: GQQRLPEWRDPDKYCPSYNKSPQSNSPVLLSRLHFEKDADSSERIIAPMR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: UPF0361 protein C3orf37

Protein Size: 354

Purification: Affinity purified

• Artikelnummer: AVIARP57365_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57365_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 56941
• Wirt: Rabbit