HMGB1 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Extracellular HMGB1 is an activator of human tumor cell migration operating in concert with EGF. HMGB1 encodes a protein that is potentially involved in the regulation of lipogenic and cholesterogenic gene transcription.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HMGB1

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: SIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: High mobility group protein B1

Protein Size: 215

Purification: Affinity Purified

• Artikelnummer: AVIARP59014_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP59014_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 3146
• Wirt: Rabbit
• Konjugat: Conjugated, FITC