HMGB1 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Extracellular HMGB1 is an activator of human tumor cell migration operating in concert with EGF. HMGB1 encodes a protein that is potentially involved in the regulation of lipogenic and cholesterogenic gene transcription.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HMGB1

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: QTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKAR

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: High mobility group protein B1

Protein Size: 215

Purification: Affinity Purified

• Artikelnummer: AVIARP59013_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP59013_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 3146
• Wirt: Rabbit
• Konjugat: Conjugated, HRP