HMGB2 Antibody - middle region : HRP

HMGB2 Antibody - middle region : HRP
Artikelnummer
AVIARP58158_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: HMGB2 is a member of the non-histone chromosomal high mobility group protein family. The proteins of this family are chromatin-associated and ubiquitously distributed in the nucleus of higher eukaryotic cells. In vitro studies have demonstrated that this

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HMGB2

Key Reference: 0

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: SEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: High mobility group protein B2

Protein Size: 209

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58158_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58158_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 3148
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×