HMGCLL1 Antibody - N-terminal region : FITC

HMGCLL1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP56277_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: HMGCLL1 is involved in the catabolism of branched amino acids such as leucine.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HMGCLL1

Key Reference: Mitchell,G.A., (1993) J. Biol. Chem. 268 (6), 4376-4381

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: MGNVPSAVKHCLSYQQLLREHLWIGDSVAGALDPAQETSQLSGLPEFVKI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytoplasmic

Protein Size: 340

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56277_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56277_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 54511
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×