Hmgn2 Antibody - N-terminal region : Biotin

Hmgn2 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP58365_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Hmgn2 bind to the inner side of the nucleosomal DNA thus altering the interaction between the DNA and the histone octamer. It may be involved in the process which maintains transcribable genes in an unique chromatin conformation.

Molecular Weight: 9kDa

Peptide Sequence: Synthetic peptide located within the following region: MPKRKAEGDAKGDKTKVKDEPQRRSARLSAKPAPPKPEPKPKKAPAKKGE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Non-histone chromosomal protein HMG-17

Protein Size: 90

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58365_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58365_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 15331
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×