Hmgn2 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Hmgn2 bind to the inner side of the nucleosomal DNA thus altering the interaction between the DNA and the histone octamer. It may be involved in the process which maintains transcribable genes in an unique chromatin conformation.

Molecular Weight: 9kDa

Peptide Sequence: Synthetic peptide located within the following region: MPKRKAEGDAKGDKTKVKDEPQRRSARLSAKPAPPKPEPKPKKAPAKKGE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Non-histone chromosomal protein HMG-17

Protein Size: 90

Purification: Affinity Purified

• Artikelnummer: AVIARP58365_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58365_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 15331
• Wirt: Rabbit
• Konjugat: Conjugated, HRP