HOOK2 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: Hook proteins are cytosolic coiled-coil proteins that contain conserved N-terminal domains, which attach to microtubules, and more divergent C-terminal domains, which mediate binding to organelles. The Drosophila Hook protein is a component of the endocytic compartment.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human HOOK2

Molecular Weight: 79kDa

Peptide Sequence: Synthetic peptide located within the following region: LRRAGSLRAQLEAQRRQVQELQGQRQEEAMKAEKWLFECRNLEEKYESVT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein Hook homolog 2

Protein Size: 719

Purification: Affinity purified

• Artikelnummer: AVIARP54934_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54934_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 29911
• Wirt: Rabbit