HOXA7 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. For example, the encoded protein represses the transcription of differentiation-specific genes during keratinocyte proliferation, but this repression is then overcome by differentiation signals. This gene is highly similar to the antennapedia (Antp) gene of Drosophila.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human HOXA7

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: IKIWFQNRRMKWKKEHKDEGPTAAAAPEGAVPSAAATAAADKADEEDDDE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Homeobox protein Hox-A7

Protein Size: 230

Purification: Affinity Purified

• Artikelnummer: AVIARP58017_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58017_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 3204
• Wirt: Rabbit