HOXD1 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: HOXD1 is a protein with a homeobox DNA-binding domain, and it belongs to the Antp homeobox family. This nuclear protein functions as a sequence-specific transcription factor that is involved in differentiation and limb development. Mutations in this gene

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HOXD1

Key Reference: Kosaki,K., (2002) Teratology 65 (2), 50-62

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: QNRRMKQKKREREGLLATAIPVAPLQLPLSGTTPTKFIKNPGSPSQSQEP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Homeobox protein Hox-D1

Protein Size: 328

Purification: Affinity Purified

• Artikelnummer: AVIARP57870_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57870_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 3231
• Wirt: Rabbit