HP1BP3 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: HP1BP3 is the component of heterochromatin, may be involved in chromatin structure and function.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HP1BP3

Key Reference: Ota,T., (2004) Nat. Genet. 36 (1), 40-45

Molecular Weight: 61kDa

Peptide Sequence: Synthetic peptide located within the following region: QYYPKLRVDIRPQLLKNALQRAVERGQLEQITGKGASGTFQLKKSGEKPL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Heterochromatin protein 1-binding protein 3

Protein Size: 553

Purification: Affinity Purified

• Artikelnummer: AVIARP56875_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56875_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 50809
• Wirt: Rabbit