HSD17B14 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: 17-beta-hydroxysteroid dehydrogenases, such as HSD17B14, are primarily involved in metabolism of steroids at the C17 position and also of other substrates, such as fatty acids, prostaglandins, and xenobiotics.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HSD17B14

Key Reference: Lukacik,P., (2007) Biochem. J. 402 (3), 419-427

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: QPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAPDIP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 17-beta-hydroxysteroid dehydrogenase 14

Protein Size: 270

Purification: Affinity Purified

• Artikelnummer: AVIARP56865_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56865_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 51171
• Wirt: Rabbit