HSD17B14 Antibody - N-terminal region : FITC

HSD17B14 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP56864_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: 17-beta-hydroxysteroid dehydrogenases, such as HSD17B14, are primarily involved in metabolism of steroids at the C17 position and also of other substrates, such as fatty acids, prostaglandins, and xenobiotics.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HSD17B14

Key Reference: Lukacik,P., (2007) Biochem. J. 402 (3), 419-427

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: RVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 17-beta-hydroxysteroid dehydrogenase 14

Protein Size: 270

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56864_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56864_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51171
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×