Hspbp1 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: Hspbp1 inhibits chaperone activity by preventing ATP binding.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Hspbp1

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: VLGALCSLVTDFPQGVRECREPELGLEELLRHRCQLLQQHEEYQEELEFC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Hsp70-binding protein 1

Protein Size: 357

Purification: Affinity Purified

• Artikelnummer: AVIARP54870_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54870_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 246146
• Wirt: Rabbit