HSPC111 Antibody - middle region : HRP

HSPC111 Antibody - middle region : HRP
Artikelnummer
AVIARP56898_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: NOP16 is transcriptionally regulated by c-Myc (MYC; MIM 190080), upregulated in breast cancer, and overexpression is associated with poor patient survival (Butt et al., 2008).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HSPC111

Key Reference: Scherl,A., (2002) Mol. Biol. Cell 13 (11), 4100-4109

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: RKVKAMEVDIEERPKELVRKPYVLNDLEAEASLPEKKGNTLSRDLIDYVR

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Nucleolar protein 16

Protein Size: 178

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56898_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56898_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51491
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×