Human beta Nerve Growth Factor Recombinant

Human beta Nerve Growth Factor Recombinant
Artikelnummer
BPS90223-A
Verpackungseinheit
5 µg
Hersteller
BPS Bioscience

Verfügbarkeit: wird geladen...
Preis wird geladen...
Products from BPS Bioscience require a minimum order value above 400€

Amino Acid Sequence: SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA

Background: NGF is mainly responsible for the survival and the differentiation and the functional activities of sensory and sympathetic neurons in the peripheral nervous system. It also plays an important role in the development and functional activities of cholinergic neurons in the central nervous system. Since NGF is synthesized also in non-neuronal tissues it may have a much wider spectrum of biological activities than thought previously. NGF stimulates chemotactic migration of human polymorphonuclear leukocytes in vitro. NGF stimulates the growth and differentiation of B-cells and the growth of T-cells and of some tumor cell types. NGF inhibits immunoglobulin production by various human plasma cell. The cytokines IL-1, IL-6, and bFGF are potent inducers of NGF. NGF induces the synthesis of IL-1 in pheochromocytoma cells which in turn acts as a growth factor for glial cells and induces the synthesis of NGF following nerve injuries. In thymic stromal cells NGF induces the synthesis of IL-6. NGF induces the synthesis of the fos oncogene and the myc oncogene and also influences the expression of EGF. One receptor that is responsible for mediating most of the activities of NGF is expressed preferentially in neuronal tissues. This glycoprotein of 140 kDa is the product of the trk gene. It possesses an intrinsic tyrosine-specific protein kinase in its intracellular domain.

Biological Activity: The ED50 was determined by the determined by its ability to proliferate TF-1 cells and was found to be in the range of  0.5 ng/ml.

Description: Recombinant human NGF is as a non disulfide-linked homodimeric protein consisting of two 118 amino acid residues, and migrates as a 13 - 14 kDa protein under reducing conditions in SDS-PAGE. Optimized DNA sequence encoding Human Nerve Growth Factor mature chain was expressed in Chinese Hamster Ovary (CHO) cells.

Endotoxin Level: <0.1 ng/µg (1 EU/µg), using the LAL gel clot method.

Format: lyophilized protein

Formulation: Lyophilized from a 0.2 µm filtered 20 mM sodium acetate, 150 mM NaCl, pH 5.5.

Genbank: P01138

Purity: ≥95% by SDS-PAGE and HPLC

Reconstitution: Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid.

Storage Stability: The lyophilized protein is stable for at least 2 years from date of receipt when stored at -20°C. Upon reconstitution, store in working aliquots at +4°C for up to one month, or at -20°C for up to six months, in the presence of a carrier protein. Avoid repeated freeze/thaw cycles.

Uniprot: P01138

Warnings: Avoid freeze/thaw cycles.

Biosafety Level: Not applicable (BSL-1)

References: 1. Chaves RN, et al. Zygote. 2013 May,21(2):187-97.
2. Cuello AC. Neurochem Res. 2012 Jun,37(6):1256-60.
3. Berry A, et al. Neural Plast. 2012,2012:784040.
Mehr Informationen
Artikelnummer BPS90223-A
Hersteller BPS Bioscience
Hersteller Artikelnummer 90223-A
Green Labware Nein
Verpackungseinheit 5 µg
Mengeneinheit STK
Wirt Hamster
Produktinformation (PDF)
×
MSDS (PDF)
×