Human GRO-alpha (CXCL1) Recombinant

Human GRO-alpha (CXCL1) Recombinant
Artikelnummer
BPS90149-B
Verpackungseinheit
25 µg
Hersteller
BPS Bioscience

Verfügbarkeit: wird geladen...
Preis wird geladen...
Products from BPS Bioscience require a minimum order value above 400€

Encompassing Amino Acids: 35-107

Amino Acid Sequence: ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN

Background: Growth regulated oncogene-alpha belongs to the family of chemotyctic cytokines called chemokines. It is identical with MGSA (melanoma growth stimulatory activity)and the new designation is CXCL1. This factor is known mainly because of its chemotactic activity. GRO expression is inducible by serum or PDGF and/or by a variety of inflammatory mediators, such as IL-1 and TNF, in monocytes, fibroblasts, melanocytes and epithelial cells. In certain tumor cell lines, GRO is expressed constitutively. Similar to other alpha chemokines, the three GRO proteins are potent neutrophil attractants and activators. In addition, these chemokines are also active toward basophils. All three GROs can bind with high affinity to the IL-8 receptor type B.

Biological Activity: Determined by the ability to chemoattract human neutrophils using a concentration range of 10.0-50.0 ng/ml.

Description: Recombinant GRO-a is a disulfide-linked homodimeric protein consisting of 74 amino acid residues, and migrates as an approximately 8 kDa protein under non-reducing and reducing conditions in SDS-PAGE. Optimized DNA sequence encoding human GRO-alpha mature chain was expressed in E. coli.

Endotoxin Level: <0.1 ng/µg (1 EU/µg), using the LAL gel clot method.

Format: lyophilized protein

Formulation: Lyophilized from 0.2 µm filtered concentrated (1 mg/ml) solution in 40 mM NaCl, 10 mM phosphate buffer, pH 7.0.

Genbank: P09341

Purity: ≥97% by SDS-PAGE and HPLC

Reconstitution: Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid.

Storage Stability: The lyophilized protein is stable for at least 2 years from date of receipt when stored at -20°C. Upon reconstitution, store in working aliquots at +4°C for up to one month, or at -20°C for up to six months, in the presence of a carrier protein. Avoid repeated freeze/thaw cycles.

Uniprot: P09341

Warnings: Avoid freeze/thaw cycles.

Biosafety Level: Not applicable (BSL-1)

References: 1. Arterioscler Thromb Vasc Biol, May 2008, 28: 1005 - 1011.
2. Clin. Cancer Res., Oct 2006, 12: 5951 - 5959.
3. Am J Physiol Lung Cell Mol Physiol, Jul 2006, 291: L66 - L74.
Mehr Informationen
Artikelnummer BPS90149-B
Hersteller BPS Bioscience
Hersteller Artikelnummer 90149-B
Verpackungseinheit 25 µg
Mengeneinheit STK
Produktinformation (PDF)
×
MSDS (PDF)
×