English
Human Interferon-alpha 2a Recombinant
Human Interferon-alpha 2a Recombinant
Artikelnummer
BPS90158-A
Verpackungseinheit
20 µg
Hersteller
BPS Bioscience
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Products from BPS Bioscience require a minimum order value above 400€
Amino Acid Sequence: CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Background: All known subtypes of IFN-alpha show the same antiviral antiparasitic, antiproliferative activities. Human IFN-alpha is also a potent antiviral substance in murine, porcine, and bovine cell systems. IFN-alpha forms are produced by monocytes/macrophages, lymphoblastoid cells, fibroblasts, and a number of different cell types following induction by viruses, nucleic acids, glucocorticoid hormones, and low-molecular weight substances. All IFN-alpha subtypes possess a common conserved sequence region between amino acid positions 115-151 while the amino- terminal ends are variable. Many IFN-alpha subtypes differ in their sequences at only one or two positions. IFN-alpha and IFN-beta are thought to bind to the same receptor. Signal transduction mechanisms elicited after binding of IFN-alpha to its receptors involves tyrosine phosphorylation of various non-receptor tyrosine kinases belonging to the Janus kinases.
Biological Activity: The activity was determined by a viral resistance assay of Human WISH cells, and was found to be in the range of 1x108 IU/mg.
Description: Recombinant Interferon alpha 2a is a disulfide-linked monomeric protein consisting of 166 amino acid residues, and migrates as an approximately 19 kDa protein under non-reducing conditions and reducing conditions in SDS-PAGE. Optimized DNA sequence encoding Human Interferon-alpha mature chain was expressed in E. coli.
Endotoxin Level: <0.1 ng/µg (1 EU/µg), using the LAL gel clot method.
Format: lyophilized protein
Formulation: Lyophilized from 0.2 µm filtered PBS solution, pH 7.0.
Genbank: P01563
Purity: ≥98% by SDS-PAGE and HPLC
Reconstitution: Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid.
Storage Stability: The lyophilized protein is stable for at least 2 years from date of receipt when stored at -20°C. Upon reconstitution, store in working aliquots at +4°C for up to one month, or at -20°C for up to six months, in the presence of a carrier protein. Avoid repeated freeze/thaw cycles.
Uniprot: P01563
Warnings: Avoid freeze/thaw cycles.
Biosafety Level: Not applicable (BSL-1)
References: 1. J. Biol. Chem., Sep 2009, 284: 25051 - 25064.
2. J. Biol. Chem., Sep 2009, 284: 24328 - 24340.
Amino Acid Sequence: CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Background: All known subtypes of IFN-alpha show the same antiviral antiparasitic, antiproliferative activities. Human IFN-alpha is also a potent antiviral substance in murine, porcine, and bovine cell systems. IFN-alpha forms are produced by monocytes/macrophages, lymphoblastoid cells, fibroblasts, and a number of different cell types following induction by viruses, nucleic acids, glucocorticoid hormones, and low-molecular weight substances. All IFN-alpha subtypes possess a common conserved sequence region between amino acid positions 115-151 while the amino- terminal ends are variable. Many IFN-alpha subtypes differ in their sequences at only one or two positions. IFN-alpha and IFN-beta are thought to bind to the same receptor. Signal transduction mechanisms elicited after binding of IFN-alpha to its receptors involves tyrosine phosphorylation of various non-receptor tyrosine kinases belonging to the Janus kinases.
Biological Activity: The activity was determined by a viral resistance assay of Human WISH cells, and was found to be in the range of 1x108 IU/mg.
Description: Recombinant Interferon alpha 2a is a disulfide-linked monomeric protein consisting of 166 amino acid residues, and migrates as an approximately 19 kDa protein under non-reducing conditions and reducing conditions in SDS-PAGE. Optimized DNA sequence encoding Human Interferon-alpha mature chain was expressed in E. coli.
Endotoxin Level: <0.1 ng/µg (1 EU/µg), using the LAL gel clot method.
Format: lyophilized protein
Formulation: Lyophilized from 0.2 µm filtered PBS solution, pH 7.0.
Genbank: P01563
Purity: ≥98% by SDS-PAGE and HPLC
Reconstitution: Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid.
Storage Stability: The lyophilized protein is stable for at least 2 years from date of receipt when stored at -20°C. Upon reconstitution, store in working aliquots at +4°C for up to one month, or at -20°C for up to six months, in the presence of a carrier protein. Avoid repeated freeze/thaw cycles.
Uniprot: P01563
Warnings: Avoid freeze/thaw cycles.
Biosafety Level: Not applicable (BSL-1)
References: 1. J. Biol. Chem., Sep 2009, 284: 25051 - 25064.
2. J. Biol. Chem., Sep 2009, 284: 24328 - 24340.
| Artikelnummer | BPS90158-A |
|---|---|
| Hersteller | BPS Bioscience |
| Hersteller Artikelnummer | 90158-A |
| Green Labware | Nein |
| Verpackungseinheit | 20 µg |
| Mengeneinheit | STK |
| Produktinformation (PDF) |
|
| MSDS (PDF) |
|
Immer für Sie da
Gernot Ensinger, M.Sc.
Laurent Haze
