Human Interferon-gamma Recombinant

Human Interferon-gamma Recombinant
Artikelnummer
BPS90162-A
Verpackungseinheit
20 µg
Hersteller
BPS Bioscience

Verfügbarkeit: wird geladen...
Preis wird geladen...
Products from BPS Bioscience require a minimum order value above 400€

Amino Acid Sequence: QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ

Background: IFN-gamma is produced mainly by T-cells and natural killer cells activated by antigens, mitogens, or alloantigens. It is produced by lymphocytes expressing the surface antigens CD4 and CD8. IFN gamma receptors are expressed on all types of human cells with the exception of mature erythrocytes. IFN-gamma-receptor complexes are rapidly internalized by endocytosis. IFN-gamma has antiviral and antiparasitic activities and also inhibits the proliferation of a number of normal and transformed cells. Interferon-gamma synergises with TNF-alpha and TNF-beta in inhibiting the proliferation of various cell types. The growth inhibitory activities of IFN-gamma are more pronounced than those of the other interferons. However, the main biological activity of IFN-gamma appears to be immunomodulatory in contrast to the other interferons that are mainly antiviral. In T-helper cells, IL-2 induces the synthesis of IFN-gamma and other cytokines. IFN- gamma acts synergistically with IL-1 and IL-2 and appears to be required for the expression of IL-2 receptors on the cell surface of T-lymphocytes. Blocking of the IL-2 receptor by specific antibodies also inhibits the synthesis of IFN-gamma.

Description: Recombinant Interferon gamma is a disulfide-linked monomer protein consisting of 144 amino acid residues, and migrates as an approximately 17 kDa protein under non-reducing and reducing conditions in SDS-PAGE. Optimized DNA sequence encoding Human Interferon-gamma mature chain was expressed in E. coli.

Endotoxin Level: <0.1 ng/µg (1 EU/µg), using the LAL gel clot method.

Format: lyophilized protein

Formulation: Lyophilized from 0.2 µm filtered concentrated (1 mg/ml) solution in PBS, pH 7.2.

Genbank: P01579

Purity: ≥98% by SDS-PAGE and HPLC

Reconstitution: Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid.

Storage Stability: The lyophilized protein is stable for at least 2 years from date of receipt when stored at -20°C. Upon reconstitution, store in working aliquots at +4°C for up to one month, or at -20°C for up to six months, in the presence of a carrier protein. Avoid repeated freeze/thaw cycles.

Uniprot: P01579

Warnings: Avoid freeze/thaw cycles.

Biosafety Level: Not applicable (BSL-1)

References: 1. Sikorski K, et al. Cytokine Growth Factor Rev. 2011 Aug,22(4):211-9.
2. Gysemans C, et al. Biochem Soc Trans. 2008 Jun,36(Pt 3):328-33.
3. Rameshwar P. Cell Res. 2008 Aug,18(8):805-6.
Mehr Informationen
Artikelnummer BPS90162-A
Hersteller BPS Bioscience
Hersteller Artikelnummer 90162-A
Green Labware Nein
Verpackungseinheit 20 µg
Mengeneinheit STK
Produktinformation (PDF)
×
MSDS (PDF)
×