Human Interleukin-10 Recombinant

Human Interleukin-10 Recombinant
Artikelnummer
BPS90173-B
Verpackungseinheit
10 µg
Hersteller
BPS Bioscience

Verfügbarkeit: wird geladen...
Preis wird geladen...
Products from BPS Bioscience require a minimum order value above 400€

Amino Acid Sequence: SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN

Background: IL-10 is produced by mouse Th2-cells following their stimulation by lectins. The main source for B-cell derived IL-10 in mice are Ly1 B-cells that express CD5 (Ly1) and CD11. In humans IL-10 is produced by activated CD8(+) peripheral blood T-cells, by T-helper CD4(+) T-cell clones after both antigen-specific and polyclonal activation, by B- cell lymphomas, and by monocytes following cell activation by bacterial lipopolysaccharides and mast cells. IL-10 is a homodimeric protein with subunits having a length of 160 amino acids. Human Interleukin-10 shows 73% amino acid homology with mouse Interleukin-10. The murine IL-10 receptor has been cloned. This receptor is a protein of approximately 110 kDa that binds murine IL-10 specifically. This receptor is structurally related to receptors for IFN. The CD nomenclature for this receptor is CDw210. IL-10 inhibits the synthesis of a number of cytokines such as IFN-gamma, IL-2 and TNF-beta in Th1 T-helper subpopulations of T-cells but not of Th2 T-helper cells. This activity is antagonized by IL-4. The inhibitory effect on IFN- gamma production is indirect and appears to be the result of a suppression of IL-12 synthesis by accessory cells. In the human system, IL-10 is produced by, and down-regulates the function of Th1 and Th2 cells.

Biological Activity: The ED50 was determined by the dose-dependent co-stimulation (with murine IL-4) of MC/9 cells. The ED50 was found to be ≤2 ng/ml, corresponding to a specific activity of≥ 4x 10^5 units/mg.

Description: Recombinant Human Interleukin-10 is a disulfide-linked monomer protein consisting of 161 amino acid residues, and migrates as an approximately 19 kDa protein under non-reducing and reducing conditions in SDS-PAGE. Optimized DNA sequence encoding human Interleukin-10 mature chain was expressed in E. coli.

Endotoxin Level: <0.1 ng/µg (1 EU/µg), using the LAL gel clot method.

Format: lyophilized protein

Formulation: Lyophilized from 0.2 µm filtered PBS, pH 7.0.

Genbank: P22301

Purity: ≥95% by SDS-PAGE and HPLC

Reconstitution: Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid.

Storage Stability: The lyophilized protein is stable for at least 2 years from date of receipt when stored at -20°C. Upon reconstitution, store in working aliquots at +4°C for up to one month, or at -20°C for up to six months, in the presence of a carrier protein. Avoid repeated freeze/thaw cycles.

Uniprot: P22301

Warnings: Avoid freeze/thaw cycles.

Biosafety Level: Not applicable (BSL-1)

References: 1. J. Immunol., Oct 2009, 183: 4475 - 4482.
2. J. Immunol., Oct 2009, 183: 4619 - 4627.
3. J. Exp. Med., Sep 2009, 206: 2235 - 2251.
Mehr Informationen
Artikelnummer BPS90173-B
Hersteller BPS Bioscience
Hersteller Artikelnummer 90173-B
Green Labware Nein
Verpackungseinheit 10 µg
Mengeneinheit STK
Produktinformation (PDF)
×
MSDS (PDF)
×